Strategic approach. Powerful follow-through. Brand communications that win. That’s how we roll.

node.jsjavascriptreactcssmongodbphpapiswordpressmysqlphpmyadminajaxexpress.jsmongooseshopify

javajavascript

Cleo is a feisty & unique Fintech startup with around 60 employees based near Angel, backed by an impressive line-up of VC’s. Our mission is to help the 99% improve their relationship with money and their financial health with simplicity and a sense of humor. Cleo’s an AI assistant defining a new category, one that goes beyond saving up to actually changing how we feel about our finances. As our series B funding shapes-up, we’re expecting big things. You will be working in one of our cross-functional squads, helping to solve our crucial uncharted engineering challenges around AI, chat, tone of voice, and applied machine learning across both our native app and Facebook Messenger platforms.

reactreact hooksruby on railsreact nativetypescriptreactnativereact jsreact/react-nativeflexible workingseries btechnology

javascriptangularhtmlcss

Depop is where the world's creatives come to buy, sell and discover the most inspiring and unique things. Depop was founded by co-founder of PIG magazine and RETROSUPERFUTURE sunglasses, Simon Beckerman. Originally a social network where PIG’s readers could buy items featured in the magazine. After realizing that Depop needed a selling function, Simon re-envisioned the app as a global marketplace — a mobile space where you can see what your friends and the people you’re inspired by are liking, buying, and selling. In turn, your friends and creative influencers all over the world can see the things you like, buy, and sell, and are inspired by you. This ecosystem has supported Depop becoming a global conduit of connection, not only in m-commerce, but culture, design, and creative communities around the world.

scalajavakinesiskafkapostgresqlplayrestawssparkdynamo dbflexible workingpension parental leave25 days

Recount Media is a media startup backed by A-list investors including USV and True Ventures focused on high quality journalism with a simple mission – to deliver the news that matters in good faith and without wasting your time or insulting your intelligence. In our fractured news environment we want to reimagine how people find and consume news making it easier than ever to stay informed. This is a fully remote role but you must be eligible to work in the US. We expect to have offices at some point post-COVID but remote will remain an option.

google cloudtypescriptreasonmlgoogle functionsreason reactpython3remote workingflexible workinghealth insurancecommitted to a diverse team flexible working for parentsunlimited vacation policystock optionsseries a

Paidy was founded with the mission to create a world of “We remove the barriers, embrace simplicity”, offering its real-time monthly consolidated credit service all across Japan. Paidy started Japan’s first instant post-pay credit service for ecommerce consumers in October 2014. Paidy requires no pre-registration or credit card to use; Paidy consumers purchase products online using only a mobile phone number and email address (verification is established though a four-digit code via SMS or voice pin-code) and settle a single monthly bill for all their purchases, either at a convenience store, by bank transfer or auto debit. Paidy also supports multi-pay installments and subscriptions. There are currently over 5,000,000 Paidy accounts in use (March 2020)!! Paidy has proved a powerful means of persuading first time buyers to transact online. Its proprietary models and machine learning mean that transactions are underwritten in seconds, with guaranteed payment to merchants. Paidy increases merchant revenues by reducing incomplete transactions, increasing conversion rates, boosting average order values, and facilitating easy repeat buying.

scalajavaakkacassandradistributed systemsci/cdkafkafunctional programmingjvmpension contributionsdiverse management teamjapanese speaking lessons2 months relocation/housingtyped functional programming

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

Founded in 2016 and headquartered in Amsterdam, Siilo is a secure medical messaging app designed to help healthcare professionals and teams better collaborate on difficult cases, improve patient care, and share knowledge in a compliant way. Today, Siilo is the largest medical network in Europe, with over a quarter-million active users who, to date, have exchanged over 200 million messages. While the Siilo Messenger app is free for individual users to download, Siilo also partners with medical associations like AGIK and KAVA, and hospitals like Charité, UMC Utrecht, and Erasmus MC to deliver organisational and departmental collaboration.

javajavascripthtmlcssandroidmobile appsawsiosremote workinggenerous ptoseedhealth

Moixa has established itself as the UK's leading provider of residential smart battery storage. Moixa invents, manufactures and distributes smart energy technology including the Moixa Smart Battery range and Moixa GridShare, a battery management platform that enables consumers and utilities to use energy in an intelligent way. The Moixa Smart Battery has already been installed in a thousand sites throughout the UK in private customer, social housing and small business environments. Moixa systems have been involved in numerous projects for Government, British Gas, Scottish Power, Good Energy and many others. The company is in a partnership with companies such as Honda, Hitachi and ITOCHU to collaborate on their battery and Electric Vehicle offerings.

haskellpythonc++javascriptci/cdaws lambdaslackfunctional javascripttypescriptawsflexible workingpension casual dresswfh fridays

pythonnode.jsreactmongodbdockerreddisdynamodbaws

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

Building banking APIs that are faster, more reliable and more performant than the big incumbents.

elixirrustliveviewstock optionscompetitive salaryseedfinance

You’ll work with Digital McKinsey in our London office. Digital McKinsey brings together the best of McKinsey’s digital capabilities to help our clients use digital technology to transform their businesses. As part of this group, you’ll join a global team working on everything from IT modernization and strategy to agile, cloud, cybersecurity, and digital transformation. You’ll typically work on projects across all industries and functions and will be fully integrated with the rest of our global firm. You’ll also work with colleagues from across McKinsey & Company to help our clients deliver breakthrough products, experiences, and businesses, both on technology and non-technology topics.Our office culture is casual, fun and social, with an emphasis on education and innovation. We have the freedom to try new ideas, experiment and are expected to be constantly learning and growing. There is also a strong emphasis on mentoring others in the group, enabling them to grow and learn.

node.jsjavascriptangularreacthtmlcssmongodbdockerkuberneteschefawshealth insurancepension performance bonus

The RealReal is the leader in authenticated luxury consignment. With an expert behind every item, we ensure everything we sell is 100% real. We have 60+ in-house gemologists, horologists and brand authenticators who inspect thousands of items available online each day. As a sustainable company, we give new life to pieces by brands from Chanel to Cartier, and hundreds more, supporting the circular economy. We make consigning effortless with free in-home pickup, drop-off service and direct shipping. At our store in SoHo NYC customers can shop, consign and meet with our experts to learn more about luxury authenticity and sustainability. Across the country at our eight Luxury Consignment Offices, clients can consign and receive free, expert valuations of their luxury goods.

erlangelixirpythonrubyjavascriptreactdockerci/cdkafkapostgresqlcloud technologymysqlremote workingflexible working

PhoneWagon is a beautiful and easy to use call tracking software that helps businesses improve their marketing spend by placing unique local phone numbers on each of their different marketing campaigns. Businesses can turn off campaigns that aren't working and for the campaigns that are working, they can quickly test new ads to further improve ROI. PhoneWagon is suitable for agencies and small businesses that are looking for an online call tracking solution to understand their customer behavior and monitor the progress of their marketing campaigns. PhoneWagon also allows businesses to communicate with customers through text messages, both manually and automated. An example of an automated text message would be for a business to send a text message based on an event like a missed call. This engages prospects and prevents them from calling the next business on the list further improving ROI.

clojuredockervue.jsawsflexible working401kseedtechnology

reactreduxtypescript

Not your ordinary booking software, Boulevard is a platform-as-a-service company transforming business management for premium appointment-based services (A $300 Billion industry). Our range of products include a backend platform (Elixir/OTP), a public GraphQL API, multiple frontend web apps for users and administrators (React), and a mobile app (React Native). We believe the right technology can transform appointment-based businesses.

elixirreactpostgresqlreact nativeremote workinghealth insurance401(k)unlimted ptoseries btechnology

Hyperscience is a technology company blazing a new path in enterprise automation with a reimagined approach to building and powering processes. The Hyperscience Platform is the world's first Software-Defined, Input-to-Outcome Automation platform used by top public companies and government organizations around the world to build and run mission-critical processes with ease and speed.

pythonreactdockerkubernetesdjangopostgresqlwebpackpostcssansibleterraformjenkinsms sqloracle sql serverremote working

With over 16,000 people worldwide, we make a huge investment in everyone, offering great career development opportunities. Our people make William Hill what it is and we offer a fast-paced environment where we have fun, celebrate success and give you all the tools you’ll need to be your best self. It’s not just our colleagues we look after – we’ve got a responsibility to our customers too and we work hard on our ambition that nobody is harmed by gambling. Join us #behindthebet and find out more.

scalajavanode.jsreactswiftdockerphpci/cdkafkapuppetreduxansiblekotlinaws